Request QuoteCatalog Number: xP463291DSQSize: 0.2-1mg

Request Quote

Recombinant 30S ribosomal protein S10 (rpsJ)

Recombinant 30S ribosomal protein S10 (rpsJ) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP463291DSQYeast1mgQuote
EP463291DSQE. coli1mgQuote
BP463291DSQBaculovirus200ugQuote
MP463291DSQMammalian Cell200ugQuote

Protein Information

SpeciesChlorobaculum parvum (strain NCIB 8327) (Chlorobium vibrioforme subsp. thiosulfatophilum (strain DSM 263 / NCIB 8327) )
UniProt IDB3QR66
Gene NamerpsJ; Locus:Cpar_0176
Protein Name
Region Expressed1-103
Expression Tag6xHis
Purity>90%
AA SequenceMAVQQKIRIKLKSYDHSLVDKWALKIIDVVKQTDAIIFGPIPLPTKTHVYTVNRSPHVDK KSREQFAFSSHKRLIEIINPTARTIDMLMKLELPSGVDVEIKS
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review