Request QuoteCatalog Number: xP457438DSQSize: 0.2-1mg

Request Quote

Recombinant 30S ribosomal protein S20 (rpsT)

Recombinant 30S ribosomal protein S20 (rpsT) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP457438DSQYeast1mgQuote
EP457438DSQE. coli1mgQuote
BP457438DSQBaculovirus200ugQuote
MP457438DSQMammalian Cell200ugQuote

Protein Information

SpeciesChlorobaculum parvum (strain NCIB 8327) (Chlorobium vibrioforme subsp. thiosulfatophilum (strain DSM 263 / NCIB 8327) )
UniProt IDB3QQG2
Gene NamerpsT; Locus:Cpar_1773
Protein Name
Region Expressed1-91
Expression Tag6xHis
Purity>90%
AA SequenceMPLHKSAEKRLRQAARRNERNRARKKELKGLLKNMQKLIDANAAKSEVESAYRAAVQKLD RLGVKRYIHANKASRKKAQLTKMLNSYTPQA
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review