Request QuoteCatalog Number: xP491552SYWSize: 0.2-1mg

Request Quote

Recombinant 30S ribosomal protein S14 (rpsN)

Recombinant 30S ribosomal protein S14 (rpsN) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP491552SYWYeast1mgQuote
EP491552SYWE. coli1mgQuote
BP491552SYWBaculovirus200ugQuote
MP491552SYWMammalian Cell200ugQuote

Protein Information

SpeciesShewanella piezotolerans (strain WP3 / JCM 13877)
UniProt IDB8CNE6
Gene NamerpsN; Locus:swp_2024
Protein Name30S ribosomal protein S14
Region Expressed1-101
Expression Tag6xHis
Purity>90%
AA SequenceMAKSSMKAREAKRAKLVAKFAEKRLALKAIISSPTTSDEDRWDAVLKLQALPRDSSSARQ RNRCSQTGRPHGFLRKFGLSRIKLREATMRGEVPGLRKASW
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review