Request QuoteCatalog Number: xP476098TMRSize: 0.2-1mg

Request Quote

Recombinant 30S ribosomal protein S10P (rps10p)

Recombinant 30S ribosomal protein S10P (rps10p) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP476098TMRYeast1mgQuote
EP476098TMRE. coli1mgQuote
BP476098TMRBaculovirus200ugQuote
MP476098TMRMammalian Cell200ugQuote

Protein Information

SpeciesThermococcus onnurineus (strain NA1)
UniProt IDB6YVG1
Gene Namerps10p; Locus:TON_0751
Protein Name
Region Expressed1-102
Expression Tag6xHis
Purity>90%
AA SequenceMQKARIKLASTNIKALNEVTDQIKQIAERTGVRMSGPIPLPTKRIRITTRKSPDGEGTAT FDRFELRVHKRLVDIEADERAMRQIMRIRVPEDVTIEIELIS
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review