Request QuoteCatalog Number: xP489735LPWSize: 0.2-1mg

Request Quote

Recombinant 30S ribosomal protein S6 (rpsF)

Recombinant 30S ribosomal protein S6 (rpsF) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP489735LPWYeast1mgQuote
EP489735LPWE. coli1mgQuote
BP489735LPWBaculovirus200ugQuote
MP489735LPWMammalian Cell200ugQuote

Protein Information

SpeciesListeria monocytogenes serotype 4a (strain HCC23)
UniProt IDB8DAM2
Gene NamerpsF; Locus:LMHCC_2626
Protein Name30S ribosomal protein S6
Region Expressed1-97
Expression Tag6xHis
Purity>90%
AA SequenceMARKYEIMYIIRPNIEEDEKKAVVERFDGILTENGAEIIESKEWGKRRLAYEINDYRDGF YHIVKLNADKADSINEFDRLAKISDDIIRHMVIKEEA
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review