Request QuoteCatalog Number: xP490359BWYSize: 0.2-1mg

Request Quote

Recombinant 30S ribosomal protein S13 (rpsM)

Recombinant 30S ribosomal protein S13 (rpsM) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP490359BWYYeast1mgQuote
EP490359BWYE. coli1mgQuote
BP490359BWYBaculovirus200ugQuote
MP490359BWYMammalian Cell200ugQuote

Protein Information

SpeciesBuchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
UniProt IDB8D9S5
Gene NamerpsM; Locus:BUAP5A_495
Protein Name30S ribosomal protein S13
Region Expressed1-118
Expression Tag6xHis
Purity>90%
AA SequenceMARIAGINIPENKHTLIALTAIYGIGKKRSKFICSIANIPEHSKIVDLNEEQIDLLRTHV AKYVIEGDLRRERTLNIKRLIDLSCYRGLRHRRSLPVHGQRTKTNARTCKGPRKPIKK
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review