Request QuoteCatalog Number: xP463376LMJSize: 0.2-1mg

Request Quote

Recombinant 30S ribosomal protein S19 (rpsS)

Recombinant 30S ribosomal protein S19 (rpsS) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP463376LMJYeast1mgQuote
EP463376LMJE. coli1mgQuote
BP463376LMJBaculovirus200ugQuote
MP463376LMJMammalian Cell200ugQuote

Protein Information

SpeciesLactobacillus casei (strain BL23)
UniProt IDB3WAL3
Gene NamerpsS; Locus:LCABL_26660
Protein Name
Region Expressed1-93
Expression Tag6xHis
Purity>90%
AA SequenceMGRSLKKGPFADAHLLKKIEAQADNDKKTVIRTWSRRSTIFPSFIGYTIAVYDGRKHVPV FVSEDMVGHKLGEFVPTRTFRGHNTDDKKTTAR
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review