Request QuoteCatalog Number: xP455596BVSSize: 0.2-1mg

Request Quote

Recombinant 30S ribosomal protein S14, chloroplastic (rps14)

Recombinant 30S ribosomal protein S14, chloroplastic (rps14) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP455596BVSYeast1mgQuote
EP455596BVSE. coli1mgQuote
BP455596BVSBaculovirus200ugQuote
MP455596BVSMammalian Cell200ugQuote

Protein Information

SpeciesBrachypodium distachyon (Purple false brome) (Trachynia distachya)
UniProt IDB3TN49
Gene Namerps14
Protein Name
Region Expressed1-103
Expression Tag6xHis
Purity>90%
AA SequenceMAKKSLIQREKKRQKLEQKYHLIRQSLKKKIRSKVSPLSLSEKTKMREKLQSLPRNSAPT RLHRRCFLTGRPRANYRDFGLSGHVLREMVYECLLPGATRSSW
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review