Request QuoteCatalog Number: xP433158CXHSize: 0.2-1mg

Request Quote

Recombinant 30S ribosomal protein S19 (rpsS)

Recombinant 30S ribosomal protein S19 (rpsS) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP433158CXHYeast1mgQuote
EP433158CXHE. coli1mgQuote
BP433158CXHBaculovirus200ugQuote
MP433158CXHMammalian Cell200ugQuote

Protein Information

SpeciesCoxiella burnetii (strain RSA 331 / Henzerling II)
UniProt IDA9NAM8
Gene NamerpsS; Locus:COXBURSA331_A0341
Protein Name30S ribosomal protein S19
Region Expressed1-95
Expression Tag6xHis
Purity>90%
AA SequenceMPRSTNKGPFVDHHLMKKVDQAQKEGSKRPIKTWSRRSMVVPEMVGLTIAIHNGRQHVPV YISENMVGHKLGEFAITRTFRAHSGDRKAKKEGEK
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review