Request QuoteCatalog Number: xP431695BPSSize: 0.2-1mg

Request Quote

Recombinant 30S ribosomal protein S18 (rpsR)

Recombinant 30S ribosomal protein S18 (rpsR) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP431695BPSYeast1mgQuote
EP431695BPSE. coli1mgQuote
BP431695BPSBaculovirus200ugQuote
MP431695BPSMammalian Cell200ugQuote

Protein Information

SpeciesBurkholderia multivorans (strain ATCC 17616 / 249)
UniProt IDA9AJW3
Gene NamerpsR; Locus:Bmul_1402, BMULJ_01841
Protein Name30S ribosomal protein S18
Region Expressed1-91
Expression Tag6xHis
Purity>90%
AA SequenceMARPTGKKFDKRRQQQNPLFKRKKFCRFTAAGVEQIDYKDTETLKDFIGENGKITPARLT GTKAHYQRQLDTAIKRARFLALLPYTDQHKA
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review