Request QuoteCatalog Number: xP529935BXESize: 0.2-1mg

Request Quote

Recombinant 2Fe-2S ferredoxin (fdx)

Recombinant 2Fe-2S ferredoxin (fdx) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP529935BXEYeast1mgQuote
EP529935BXEE. coli1mgQuote
BP529935BXEBaculovirus200ugQuote
MP529935BXEMammalian Cell200ugQuote

Protein Information

SpeciesBuchnera aphidicola subsp. Schizaphis graminum (strain Sg)
UniProt IDO51882
Gene Namefdx; Locus:BUsg_581
Protein Name2Fe-2S ferredoxin
Region Expressed1-111
Expression Tag6xHis
Purity>90%
AA SequenceMPKIFFLPHKLLLPKGGCFECKEGETILNVALKNNIKLEHACEKSCACSTCHCIIRKGFL SLSGWSEKEEDVLDKAWGLESTSRLSCQAIIGNIDIEVQIPLYNTNYIIEN
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review