Request QuoteCatalog Number: xP014881MOSize: 0.2-1mg

Request Quote

Recombinant 28S ribosomal protein S12, mitochondrial (Mrps12)

Recombinant 28S ribosomal protein S12, mitochondrial (Mrps12) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP014881MOYeast1mgQuote
EP014881MOE. coli1mgQuote
BP014881MOBaculovirus200ugQuote
MP014881MOMammalian Cell200ugQuote

Protein Information

SpeciesMus musculus (Mouse)
UniProt IDO35680
Gene NameMrps12; aka: Rpms12
Protein Name28S ribosomal protein S12, mitochondrial
Region Expressed30-139
Expression Tag6xHis
Purity>90%
AA SequenceMATLNQMHRLGPRKEPPKRLGPTEGRPQLKGVVLRTFIRKPKKPNSANRKCCRVRLSTGK EAVCFIPGEGHTLQEHHVVLVEGGRTQDLPGVKLKVVRGKYDCGHVQKKK
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review