Request QuoteCatalog Number: xP318458DIRSize: 0.2-1mg

Request Quote

Recombinant 14 kDa proline-rich protein DC2.15

Recombinant 14 kDa proline-rich protein DC2.15 can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP318458DIRYeast1mgQuote
EP318458DIRE. coli1mgQuote
BP318458DIRBaculovirus200ugQuote
MP318458DIRMammalian Cell200ugQuote

Protein Information

SpeciesDaucus carota (Carrot)
UniProt IDP14009
Gene Name
Protein Name14 kDa proline-rich protein DC2.15
Region Expressed26-137
Expression Tag6xHis
Purity>90%
AA SequenceTEKCPDPYKPKPKPTPKPTPTPYPSAGKCPRDALKLGVCADVLNLVHNVVIGSPPTLPCC SLLEGLVNLEAAVCLCTAIKANILGKNLNLPIALSLVLNNCGKQVPNGFECT
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review