Request QuoteCatalog Number: xP340672PUTSize: 0.2-1mg

Request Quote

Recombinant 12.0 kDa protein

Recombinant 12.0 kDa protein can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP340672PUTYeast1mgQuote
EP340672PUTE. coli1mgQuote
BP340672PUTBaculovirus200ugQuote
MP340672PUTMammalian Cell200ugQuote

Protein Information

SpeciesPseudomonas phage Pf1 (Bacteriophage Pf1)
UniProt IDP25132
Gene Name
Protein Name12.0 kDa protein
Region Expressed1-110
Expression Tag6xHis
Purity>90%
AA SequenceMLANTLKALLLLCLIQAARTVADPVKGRAPGSSEQLHRSGERKHGRSAPLNASPLKQPPL GSVGQLLRPALPSTRRQERDDKGRALGVNRLESYSFRRKSKCSLLHFVAQ
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review