Request QuoteCatalog Number: xP305145ENVSize: 0.2-1mg

Request Quote

Recombinant 1,2-phenylacetyl-CoA epoxidase, subunit B (paaB)

Recombinant 1,2-phenylacetyl-CoA epoxidase, subunit B (paaB) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP305145ENVYeast1mgQuote
EP305145ENVE. coli1mgQuote
BP305145ENVBaculovirus200ugQuote
MP305145ENVMammalian Cell200ugQuote

Protein Information

SpeciesEscherichia coli (strain K12)
UniProt IDP76078
Gene NamepaaB; aka: ynbF; Locus:b1389, JW1384
Protein Name1,2-phenylacetyl-CoA epoxidase, subunit B
Region Expressed1-95
Expression Tag6xHis
Purity>90%
AA SequenceMSNVYWPLYEVFVRGKQGLSHRHVGSLHAADERMALENARDAYTRRSEGCSIWVVKASEI VASQPEERGEFFDPAESKVYRHPTFYTIPDGIEHM
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review