Request QuoteCatalog Number: xP311540PQZSize: 0.2-1mg

Request Quote

Recombinant 12 kDa protein

Recombinant 12 kDa protein can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP311540PQZYeast1mgQuote
EP311540PQZE. coli1mgQuote
BP311540PQZBaculovirus200ugQuote
MP311540PQZMammalian Cell200ugQuote

Protein Information

SpeciesPotato virus M (strain German) (PVM)
UniProt IDQ01687
Gene Name
Protein Name12 kDa protein
Region Expressed1-108
Expression Tag6xHis
Purity>90%
AA SequenceMKDVTKVALLIARAMCTSSGTFVFELAFSIAECAGRPLGGGRSKYARRRRAISIARCHRC YRLWPPTVFTTRCDNKYCVPGISYNVRVAQFIDEGVTEVIPSVINKRE
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review