Request QuoteCatalog Number: xP334937SVGSize: 0.2-1mg

Request Quote

Recombinant 12 kDa heat shock protein (HSP12)

Recombinant 12 kDa heat shock protein (HSP12) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP334937SVGYeast1mgQuote
EP334937SVGE. coli1mgQuote
BP334937SVGBaculovirus200ugQuote
MP334937SVGMammalian Cell200ugQuote

Protein Information

SpeciesSaccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
UniProt IDP22943
Gene NameHSP12; aka: GLP1, HOR5; Locus:YFL014W
Protein Name12 kDa heat shock protein
Region Expressed1-109
Expression Tag6xHis
Purity>90%
AA SequenceMSDAGRKGFGEKASEALKPDSQKSYAEQGKEYITDKADKVAGKVQPEDNKGVFQGVHDSA EKGKDNAEGQGESLADQARDYMGAAKSKLNDAVEYVSGRVHGEEDPTKK
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review