Request QuoteCatalog Number: xP526732TRASize: 0.2-1mg

Request Quote

Recombinant 11.9 kDa wall protein (TDF-1)

Recombinant 11.9 kDa wall protein (TDF-1) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP526732TRAYeast1mgQuote
EP526732TRAE. coli1mgQuote
BP526732TRABaculovirus200ugQuote
MP526732TRAMammalian Cell200ugQuote

Protein Information

SpeciesTuber dryophilum (Truffle)
UniProt IDO74703
Gene NameTDF-1
Protein Name11.9 kDa wall protein
Region Expressed7-114
Expression Tag6xHis
Purity>90%
AA SequenceAVAESTYYIKSGAYYLAVTPERQIITQNTVYAWEVSIEGEYNYLKDPGTTHYLTDNGGQN LLNPRSDVDGKWGGGSEDQATQLINAETEKPLSVPYGQPFQTWLFVKV
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review