Request QuoteCatalog Number: xP325999CDXSize: 0.2-1mg

Request Quote

Recombinant 11.6 kDa protein (TUC)

Recombinant 11.6 kDa protein (TUC) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP325999CDXYeast1mgQuote
EP325999CDXE. coli1mgQuote
BP325999CDXBaculovirus200ugQuote
MP325999CDXMammalian Cell200ugQuote

Protein Information

SpeciesCarnation latent virus (CLV)
UniProt IDP22625
Gene NameTUC
Protein Name11.6 kDa protein
Region Expressed1-101
Expression Tag6xHis
Purity>90%
AA SequenceMRERKLRKQLEDLFKRFASVQHGHSDCINIIIAKIKSDQPGESKYARRRRAKSIARCPRC ARVSPGFYFTTRCDGKTCRPGLSARPDLLEFIGIDLCVRSK
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review