Request QuoteCatalog Number: xP322052TQFSize: 0.2-1mg

Request Quote

Recombinant 11 kDa excretory-secretory protein

Recombinant 11 kDa excretory-secretory protein can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP322052TQFYeast1mgQuote
EP322052TQFE. coli1mgQuote
BP322052TQFBaculovirus200ugQuote
MP322052TQFMammalian Cell200ugQuote

Protein Information

SpeciesTrichostrongylus colubriformis (Black scour worm)
UniProt IDP21937
Gene Name
Protein Name11 kDa excretory-secretory protein
Region Expressed1-92
Expression Tag6xHis
Purity>90%
AA SequenceMLYKKLRSQGNFRKNDSAYFKLENKRELKGDNLPVEEKVRQTIEKFKDDVSEIRRLADDS DFGCNGKETGGAMHIVCFFQKNYDWMKGQWQN
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review