Request QuoteCatalog Number: xP323450PRBSize: 0.2-1mg

Request Quote

Recombinant 10.7 kDa protein

Recombinant 10.7 kDa protein can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP323450PRBYeast1mgQuote
EP323450PRBE. coli1mgQuote
BP323450PRBBaculovirus200ugQuote
MP323450PRBMammalian Cell200ugQuote

Protein Information

SpeciesPotato virus S (strain Peruvian)
UniProt IDP16654
Gene Name
Protein Name10.7 kDa protein
Region Expressed1-93
Expression Tag6xHis
Purity>90%
AA SequenceMKAERLEMLLLCVYRLGYILPVDVCIKIISVAQVSVQGRSTYSCKRRARSIGRCWRCYRV YPPVCNSKCDNRTCRPGISPNFKVVTFIRGWSN
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review