Request QuoteCatalog Number: xP328516PUTSize: 0.2-1mg

Request Quote

Recombinant 10.1 kDa protein

Recombinant 10.1 kDa protein can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP328516PUTYeast1mgQuote
EP328516PUTE. coli1mgQuote
BP328516PUTBaculovirus200ugQuote
MP328516PUTMammalian Cell200ugQuote

Protein Information

SpeciesPseudomonas phage Pf1 (Bacteriophage Pf1)
UniProt IDP25135
Gene Name
Protein Name10.1 kDa protein
Region Expressed1-90
Expression Tag6xHis
Purity>90%
AA SequenceMEESGIVGFTVTGAVEKVTDFRTAPFCSQAVFAQMLGLEDITEDVVRGWVETKTIPTAKI GRRRVVNLHRIRRDLDRGKSIFCQGDYDGD
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review