Request QuoteCatalog Number: xP896203OFHSize: 0.2-1mg

Request Quote

Recombinant 10 kDa heat shock protein, mitochondrial (hspe1)

Recombinant 10 kDa heat shock protein, mitochondrial (hspe1) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP896203OFHYeast1mgQuote
EP896203OFHE. coli1mgQuote
BP896203OFHBaculovirus200ugQuote
MP896203OFHMammalian Cell200ugQuote

Protein Information

SpeciesOryzias latipes (Medaka fish) (Japanese ricefish)
UniProt IDQ9W6X3
Gene Namehspe1; aka: hsp10
Protein Name10 kDa heat shock protein, mitochondrial
Region Expressed1-99
Expression Tag6xHis
Purity>90%
AA SequenceMAFRKFLPLFDRVLVERLMAETVTKGGIMLPEKSQGKVLQATVVAVGPGSMNQKGEVQPM SVKVGEKVLLPQYGGTKVVLEDKDYFLFRDADILGKYVD
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review