Request QuoteCatalog Number: xP010865RASize: 0.2-1mg

Request Quote

Recombinant 10 kDa heat shock protein, mitochondrial (Hspe1)

Recombinant 10 kDa heat shock protein, mitochondrial (Hspe1) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP010865RAYeast1mgQuote
EP010865RAE. coli1mgQuote
BP010865RABaculovirus200ugQuote
MP010865RAMammalian Cell200ugQuote

Protein Information

SpeciesRattus norvegicus (Rat)
UniProt IDP26772
Gene NameHspe1
Protein Name10 kDa heat shock protein, mitochondrial
Region Expressed2-102
Expression Tag6xHis
Purity>90%
AA SequenceAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGGKGKGGEIQ PVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review