Request QuoteCatalog Number: xP853724RCUSize: 0.2-1mg

Request Quote

Recombinant 10 kDa chaperonin 5 (groS5)

Recombinant 10 kDa chaperonin 5 (groS5) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP853724RCUYeast1mgQuote
EP853724RCUE. coli1mgQuote
BP853724RCUBaculovirus200ugQuote
MP853724RCUMammalian Cell200ugQuote

Protein Information

SpeciesRhizobium loti (strain MAFF303099) (Mesorhizobium loti)
UniProt IDQ981K0
Gene NamegroS5; aka: groES5; Locus:msr9341
Protein Name10 kDa chaperonin 5
Region Expressed1-98
Expression Tag6xHis
Purity>90%
AA SequenceMAKSKFRPLHDRVVVRRVESESKTAGGIIIPDTAKEKPQEGEIIAVGSGARDEAGKLVPL DVKAGDRILFGKWSGTEVKLNGEDLLIMKESDIMGIIG
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review