Request QuoteCatalog Number: xP867770VEXSize: 0.2-1mg

Request Quote

Recombinant 10 kDa chaperonin 2 (groS2)

Recombinant 10 kDa chaperonin 2 (groS2) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP867770VEXYeast1mgQuote
EP867770VEXE. coli1mgQuote
BP867770VEXBaculovirus200ugQuote
MP867770VEXMammalian Cell200ugQuote

Protein Information

SpeciesVibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
UniProt IDQ9KLC7
Gene NamegroS2; aka: groES2; Locus:VC_A0819
Protein Name10 kDa chaperonin 2
Region Expressed1-96
Expression Tag6xHis
Purity>90%
AA SequenceMNIRPLHDKLIVERLEVENKSEGGIVLTSQSVKKSNRGKVVAVGLGRPLKNGDRARMEVK TGDQIIFNDGYGVKTEKVDGKEYLILSESDVLAIVE
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review