Request QuoteCatalog Number: xP842350RKUSize: 0.2-1mg

Request Quote

Recombinant 10 kDa chaperonin 4 (groS4)

Recombinant 10 kDa chaperonin 4 (groS4) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP842350RKUYeast1mgQuote
EP842350RKUE. coli1mgQuote
BP842350RKUBaculovirus200ugQuote
MP842350RKUMammalian Cell200ugQuote

Protein Information

SpeciesRhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)
UniProt IDQ92ZQ3
Gene NamegroS4; aka: groES2; Locus:RA0396; ORFs:SMa0745
Protein Name10 kDa chaperonin 4
Region Expressed1-98
Expression Tag6xHis
Purity>90%
AA SequenceMASTDFRPLHDRVVVRRVESEEKTKGGVIIPDTAKEKPQEGEIVAVGSGARDESGKVVPL DVKAGDRILFGKWSGTEVKINGEDLLIMKEADIMGVIG
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review