Request QuoteCatalog Number: xP745365VCQSize: 0.2-1mg

Request Quote

Recombinant 10 kDa chaperonin 1 (groS1)

Recombinant 10 kDa chaperonin 1 (groS1) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP745365VCQYeast1mgQuote
EP745365VCQE. coli1mgQuote
BP745365VCQBaculovirus200ugQuote
MP745365VCQMammalian Cell200ugQuote

Protein Information

SpeciesVibrio vulnificus (strain YJ016)
UniProt IDQ7M7I6
Gene NamegroS1; aka: groES1; Locus:VV3107
Protein Name10 kDa chaperonin 1
Region Expressed1-96
Expression Tag6xHis
Purity>90%
AA SequenceMNIRPLHDRVIVERQEVESKSAGGIVLTGSAAEKSTRGVVLAVGKGRILENGTVQPLDVK VGDTVIFAESYGTKTEKIDGKEVLIMSENDIMAIVD
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review