Request QuoteCatalog Number: xP402493CWXSize: 0.2-1mg

Request Quote

Recombinant 10 kDa chaperonin (groS)

Recombinant 10 kDa chaperonin (groS) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP402493CWXYeast1mgQuote
EP402493CWXE. coli1mgQuote
BP402493CWXBaculovirus200ugQuote
MP402493CWXMammalian Cell200ugQuote

Protein Information

SpeciesClostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
UniProt IDA5N5D6
Gene NamegroS; aka: groES; Locus:CKL_0463
Protein Name10 kDa chaperonin
Region Expressed1-94
Expression Tag6xHis
Purity>90%
AA SequenceMKIRPLGDRVVIKKIEAEETTKSGIVLPGSAKEKPQEAEIVAVGPGGVIDGKEIKMEVKV GDRVLFSKYAGNEVKIDGVEYTILRQDDILAIIE
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review