Request QuoteCatalog Number: xP894390Size: 0.2-1mg

Request Quote

Recombinant 10 kDa chaperonin (groS)

Recombinant 10 kDa chaperonin (groS) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP894390Yeast1mgQuote
EP894390E. coli1mgQuote
BP894390Baculovirus200ugQuote
MP894390Mammalian Cell200ugQuote

Protein Information

SpeciesMethylovorus sp. (strain SS1 / DSM 11726)
UniProt IDQ9WWL3
Gene NamegroS; aka: groES
Protein Name10 kDa chaperonin
Region Expressed1-105
Expression Tag6xHis
Purity>90%
AA SequenceMSIRPLYDKVVVKRIEAQRTTASGIVIPDTASEKPEQGEVIATGNGRRLQDGTQVPLEVK VGDQVLFGKYAGQTVKLHGEELLVLREEDILGVVEASDAKLKKVA
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review