Request QuoteCatalog Number: xP664141Size: 0.2-1mg

Request Quote

Recombinant 10 kDa chaperonin (groS)

Recombinant 10 kDa chaperonin (groS) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP664141Yeast1mgQuote
EP664141E. coli1mgQuote
BP664141Baculovirus200ugQuote
MP664141Mammalian Cell200ugQuote

Protein Information

SpeciesPelodictyon luteolum (strain DSM 273) (Chlorobium luteolum (strain DSM 273) )
UniProt IDQ3B5F6
Gene NamegroS; aka: groES; Locus:Plut_0541
Protein Name10 kDa chaperonin
Region Expressed1-95
Expression Tag6xHis
Purity>90%
AA SequenceMNLKPLADRVIVKPAPAEEKTKGGLYIPDTGKEKPMYGEVVAVGAGKMSDSGQLLAMPVK AGDKVLYGKYSGTEVSVEGEDYLIMRESDIFAILA
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review