Request QuoteCatalog Number: xP601712Size: 0.2-1mg

Request Quote

Recombinant 10 kDa chaperonin (groS)

Recombinant 10 kDa chaperonin (groS) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP601712Yeast1mgQuote
EP601712E. coli1mgQuote
BP601712Baculovirus200ugQuote
MP601712Mammalian Cell200ugQuote

Protein Information

SpeciesHyphomonas neptunium (strain ATCC 15444)
UniProt IDQ0C0T1
Gene NamegroS; aka: groES; Locus:HNE_1961
Protein Name10 kDa chaperonin
Region Expressed1-96
Expression Tag6xHis
Purity>90%
AA SequenceMKLRPLHDRVVVRRVKEEEKTKGGIIIPDNAKEKPQEGIIVAVGNGAIGDDNERVPLDVK KGDRVLFGKWSGTEVKIDGEDLLIMKESDIMGILDK
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review