Request QuoteCatalog Number: xP311056SKYSize: 0.2-1mg

Request Quote

Recombinant 10 kDa chaperonin (groS)

Recombinant 10 kDa chaperonin (groS) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP311056SKYYeast1mgQuote
EP311056SKYE. coli1mgQuote
BP311056SKYBaculovirus200ugQuote
MP311056SKYMammalian Cell200ugQuote

Protein Information

SpeciesStaphylococcus aureus (strain N315)
UniProt IDP99104
Gene NamegroS; aka: groES, hsp10; Locus:SA1837
Protein Name10 kDa chaperonin
Region Expressed1-94
Expression Tag6xHis
Purity>90%
AA SequenceMLKPIGNRVIIEKKEQEQTTKSGIVLTDSAKEKSNEGVIVAVGTGRLLNDGTRVTPEVKE GDRVVFQQYAGTEVKRDNETYLVLNEEDILAVIE
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review