Request QuoteCatalog Number: xP342908MLNSize: 0.2-1mg

Request Quote

Recombinant 10 kDa chaperonin (groS)

Recombinant 10 kDa chaperonin (groS) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP342908MLNYeast1mgQuote
EP342908MLNE. coli1mgQuote
BP342908MLNBaculovirus200ugQuote
MP342908MLNMammalian Cell200ugQuote

Protein Information

SpeciesMycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195)
UniProt IDP47633
Gene NamegroS; aka: groES, mopB; Locus:MG393
Protein Name10 kDa chaperonin
Region Expressed1-110
Expression Tag6xHis
Purity>90%
AA SequenceMNITPIHDNVLVSLVESNKEEVSKKGIITSLASNDKSDANANKGIVIALGAGPAYGKTEK PKYAFGVGDIIYFKEYSGISFENEGNKYKIIGFEDVLAFEKPESGKQRKR
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review