Request QuoteCatalog Number: xP490099EPVSize: 0.2-1mg

Request Quote

Recombinant 10 kDa chaperonin (groS)

Recombinant 10 kDa chaperonin (groS) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP490099EPVYeast1mgQuote
EP490099EPVE. coli1mgQuote
BP490099EPVBaculovirus200ugQuote
MP490099EPVMammalian Cell200ugQuote

Protein Information

SpeciesCyanothece sp. (strain PCC 7425 / ATCC 29141)
UniProt IDB8HQ34
Gene NamegroS; aka: groES; Locus:Cyan7425_5138
Protein Name10 kDa chaperonin
Region Expressed1-103
Expression Tag6xHis
Purity>90%
AA SequenceMAAVSLSVSTVKPLGDRVFVKVSASEEKTAGGILLPDTAKEKPQVGEIVAVGPGKRNDDG SRQEPEVKIGDKVLYSKYAGTDIKLGTEEYVLLSEKDILAIVA
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review