Request QuoteCatalog Number: xP453262GFOSize: 0.2-1mg

Request Quote

Recombinant 10 kDa chaperonin (groS)

Recombinant 10 kDa chaperonin (groS) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP453262GFOYeast1mgQuote
EP453262GFOE. coli1mgQuote
BP453262GFOBaculovirus200ugQuote
MP453262GFOMammalian Cell200ugQuote

Protein Information

SpeciesGeobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
UniProt IDB3E8F9
Gene NamegroS; aka: groES; Locus:Glov_2928
Protein Name
Region Expressed1-96
Expression Tag6xHis
Purity>90%
AA SequenceMKLRPLHDRIIVKRLEGEEKTAGGLFIPDTAKEKPQKGEVIAVGNGKKNDEGKCAPLDVK VGDSILFGKYAGTEVKVDGDEFLMMREDDVLAVIEK
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review