Request QuoteCatalog Number: xP535686DSHSize: 0.2-1mg

Request Quote

Recombinant 10 kDa chaperonin (groS)

Recombinant 10 kDa chaperonin (groS) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog NumberExpression HostAmountIn Stock
YP535686DSHYeast1mgQuote
EP535686DSHE. coli1mgQuote
BP535686DSHBaculovirus200ugQuote
MP535686DSHMammalian Cell200ugQuote

Protein Information

SpeciesChlamydia trachomatis serovar L2b (strain UCH-1/proctitis)
UniProt IDB0BB98
Gene NamegroS; aka: groES; Locus:CTLon_0362
Protein Name10 kDa chaperonin
Region Expressed1-102
Expression Tag6xHis
Purity>90%
AA SequenceMSDQATTLKIKPLGDRILVKREEEASTARGGIILPDTAKKKQDRAEVVALGTGKKDDKGQ QLPFEVQVGDIVLIDKYSGQELTVEGEEYVIVQMSEVIAVLQ
Storage BufferPBS pH 7.4, 50% glycerol
StorageStore working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review