Request QuoteCatalog Number: xP018403HUSize: 0.2-1mg

Request Quote

Recombinant Human POU domain, class 5, transcription factor 1 (Pou5f1)

Recombinant Human POU domain, class 5, transcription factor 1 (Pou5f1) can be expressed and purified from different hosts. E. coli and yeast offers the best yields and shorter turnaround times. Expression in insect cells with baculovirus or mammalian cells can provide many of the posttranslational modifications necessary for correct protein folding or retain the proteins activity.

Catalog Number Expression Host Amount In Stock
YP018403HU Yeast 1mg Quote
EP018403HU E. coli 1mg RPA424Hu01
BP018403HU Baculovirus 200ug Quote
MP018403HU Mammalian Cell 200ug Quote

Protein Information

Species Human
UniProt ID Q01860
Gene Name POU5F1
Protein Name POU domain, class 5, transcription factor 1Alternative name(s): Octamer-binding protein 3 Short name= Oct-3 Octamer-binding transcription factor 3 Short name= OTF-3
Region Expressed 1-360 aa
Expression Tag 6xHis
Purity >90%
AA Sequence MAGHLASDFAFSPPPGGGGDGPGGPEPGWVDPRTWLSFQGPPGGPGIGPGVGPGSEVWGI PPCPPPYEFCGGMAYCGPQVGVGLVPQGGLETSQPEGEAGVGVESNSDGASPEPCTVTPG AVKLEKEKLEQNPEESQDIKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFS QTTICRFEALQLSFKNMCKLRPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENR VRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEA AGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN
Storage Buffer PBS pH 7.4, 50% glycerol
Storage Store working aliquots at 4oC for upto a week. Freeze at -20 to -80oC for long term storage. Avoid repeated freeze/thaw.
Request Quote
ReviewsWrite Review